PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00030349-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 316aa    MW: 35475.9 Da    PI: 9.9116
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00030349-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-14135179347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  WALNUT_00030349-RA 135 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 179
                         8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.8352479IPR017884SANT domain
SMARTSM007174.5E-82577IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-102782IPR009057Homeodomain-like
CDDcd001678.92E-72875No hitNo description
PROSITE profilePS5129420.728128184IPR017930Myb domain
SuperFamilySSF466897.48E-17129183IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-17131183IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-12132179IPR009057Homeodomain-like
SMARTSM007173.2E-13132182IPR001005SANT/Myb domain
CDDcd001671.65E-11135180No hitNo description
PfamPF002495.7E-13135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKWEMEILSP ATYISNANWL LDESKSTKWT PAENKMFENA LAVYDKESPD RWPKVAAMIP  60
GKTVLDVMRQ YEELVADINN IEAGLVTIPG YAASPFTLDG VNSNGYDGFR QSYGIGGKRS  120
SSARSAEQER KKGVPWTEEE HKLFLMGLKK YGKGDWRNIS RNFVITRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT VNIVDMKMPS PDSKRPSSPE HSTVLHPQQQ QQQQQRNSAA  240
ATPRTPFQWN QSNGGATMAF NTTHGNVFMT SPYGIVSSYG QKMQGHNLQR GVSHESYMGA  300
PNMVFQMHSA QHYPLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1629911173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445667.11e-171PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-140DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2TGI11e-171A0A0D2TGI1_G
STRINGPOPTR_0001s25590.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-99Homeodomain-like transcriptional regulator